Rad21/Rec8-like (a.4.5.57)


SCOP classification
 
Class: All alpha proteins
Fold: DNA/RNA-binding 3-helical bundle
Superfamily: "Winged helix" DNA-binding domain
Family: Rad21/Rec8-like



Orphan Member
 
Domain: d1w1wh_ of protein: Sister chromatid cohesion protein 1 (SCC1), C-terminal domain from Species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]




>1w1wh_(a.4.5.57)
KAIVQMAKILRKELSEEKEVIFTDVLKSQAKREASRGFFDILSLATEGCIGLSQTEAFGNIKIDAKPALFE

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)