An Obfc1 domain (a.4.5.59)


SCOP classification
 
Class: All alpha proteins
Fold: DNA/RNA-binding 3-helical bundle
Superfamily: "Winged helix" DNA-binding domain
Family: An Obfc1 domain



Orphan Member
 
Domain: d1wj5a_ of protein: OB fold-containing protein 1, Obfc1 from Species: Mouse (Mus musculus) [TaxId: 10090]




>1wj5a_(a.4.5.59)
GSSGSSGNKDNLDLAGLTSLLSEKIKEFLQEKKMQSFYQQELETVESLQSLASRPVTHSTGSDQVELKDSGTSGVAQRVFKNALQLLQEKGLVFQRDSGSDKLYYVTTKDKDLQSGPSSG

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)