PH0730 N-terminal domain-like (a.4.5.72)


SCOP classification
 
Class: All alpha proteins
Fold: DNA/RNA-binding 3-helical bundle
Superfamily: "Winged helix" DNA-binding domain
Family: PH0730 N-terminal domain-like



Orphan Member
 
Domain: d2p8ta1 of protein: Hypothetical protein PH0730 from Species: Pyrococcus horikoshii [TaxId: 53953]




>d2p8ta1|a.4.5.72
EYTVEDVLAVIFLLKEPLGRKQISERLELGEGSVRTLLRKLSHLDIIRSKGHFLTLKGKE
IRDKLLS

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)