FaeA-like (a.4.5.73)


SCOP classification
 
Class: All alpha proteins
Fold: DNA/RNA-binding 3-helical bundle
Superfamily: "Winged helix" DNA-binding domain
Family: FaeA-like



Orphan Member
 
Domain: d2htja1 of protein: P fimbrial regulatory protein PapI from Species: Escherichia coli [TaxId: 562]




>d2htja1|a.4.5.73
MKNEILEFLNRHNGGKTAEIAEALAVTDYQARYYLLLLEKAGMVQRSPLRRGMATYWFLK
GEKQAGQSCSSTT

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)