STY4665 C-terminal domain-like (a.4.5.74)


SCOP classification
 
Class: All alpha proteins
Fold: DNA/RNA-binding 3-helical bundle
Superfamily: "Winged helix" DNA-binding domain
Family: STY4665 C-terminal domain-like



Orphan Member
 
Domain: d2ipqx1 of protein: Hypothetical protein STY4665 from Species: Salmonella typhi [TaxId: 90370]




>d2ipqx1|a.4.5.74
LSSTELGDLFWSWLRDGLREGDIPVNTADACVHLTCGFVFISVPGVFFLFLKSHGRKEQV
QAAFEKRKHRVSDSRRFWQCCLYEEPGGRGRYKKLTGYLIKSEIYNGNFPDDSLFLKVI

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)