YjcQ-like (a.4.5.77)


SCOP classification
 
Class: All alpha proteins
Fold: DNA/RNA-binding 3-helical bundle
Superfamily: "Winged helix" DNA-binding domain
Family: YjcQ-like



Orphan Member
 
Domain: d2hgca1 of protein: Uncharacterized protein YjcQ from Species: Bacillus subtilis [TaxId: 1423]




>d2hgca1|a.4.5.77
KLRYAILKEIFEGNTPLSENDIGVTEDQFDDAVNFLKREGYIIGVHYSDDRPHLYKLGPE
LTEKGENYLKENGTWSKA

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)