F112-like (a.4.5.78)


SCOP classification
 
Class: All alpha proteins
Fold: DNA/RNA-binding 3-helical bundle
Superfamily: "Winged helix" DNA-binding domain
Family: F112-like



Orphan Member
 
Domain: d2vqca1 of protein: F-112 from Species: Sulfolobus virus-like particle SSV1 [TaxId: 244589]




>d2vqca1|a.4.5.78
TLNSYKAEIYKILEKKGELTLEDILAQFEISVPSAYNIQRALKAICERHPDECEVQYKNR
KTTFKWIK

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)