PF0610-like (a.4.5.82)


SCOP classification
 
Class: All alpha proteins
Fold: DNA/RNA-binding 3-helical bundle
Superfamily: "Winged helix" DNA-binding domain
Family: PF0610-like



Orphan Member
 
Domain: d2gmga1 of protein: Hypothetical protein PF0610 from Species: Pyrococcus furiosus [TaxId: 2261]




>d2gmga1|a.4.5.82
AHHHHHHGSATRREKIIELLLEGDYSPSELARILDMRGKGSKKVILEDLKVISKIAKREG
MVLLIKPAQCRKCGFVFKAEINIPSRCPKCKSEWIEEPRFKLERK

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)