Rps19E-like (a.4.5.84)


SCOP classification
 
Class: All alpha proteins
Fold: DNA/RNA-binding 3-helical bundle
Superfamily: "Winged helix" DNA-binding domain
Family: Rps19E-like



Orphan Member
 
Domain: d2v7fa1 of protein: Ribosomal protein S19e from Species: Pyrococcus abyssi [TaxId: 29292]




>d2v7fa1|a.4.5.84
ATVYDVPGDLLVERVAQRLKEIPEIKPPEWAPFVKTLPEQEDWWYYRVASILRRVYLDGP
VGIERLRTYYGGGHAPERFYKAGGSIIRKALQQLEAAGFVEKVPGKGRVITPKGRSFLDK
IATELKKELEEIIPELKKY

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)