Hook domain (a.40.3.1)


SCOP classification
 
Class: All alpha proteins
Fold: CH domain-like
Superfamily: Hook domain
Family: Hook domain



Orphan Member
 
Domain: d1wixa_ of protein: Hook homolog 1, Hook1 from Species: Mouse (Mus musculus) [TaxId: 10090]




>1wixa_(a.40.3.1)
GSSGSSGLPLCDSLIIWLQTFKTASPCQDVKQLTNGVTMAQVLHQIDVAWFSESWLSRIKDDVGDNWRIKASNLKKVLHGITSYYHEFLGQQISEELIPDLNQITECADPVELGRLLQLILGCAVNCEKKQEHIKNIMTLEESVQHVVMTAIQELMSKSGPSSG

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)