Omega transcriptional repressor (a.43.1.4)


SCOP classification
 
Class: All alpha proteins
Fold: Ribbon-helix-helix
Superfamily: Ribbon-helix-helix
Family: Omega transcriptional repressor



Orphan Member
 
Domain: d2caxd_ of protein: automated matches from Species: Streptococcus pyogenes [TaxId: 1314]




>1irqa_(a.43.1.4)
IMGDKTVRVRADLHHIIKIETAKNGGNVKEVMDQALEEYIRKYLPDKL

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)