NE0241-like (a.43.1.6)


SCOP classification
 
Class: All alpha proteins
Fold: Ribbon-helix-helix
Superfamily: Ribbon-helix-helix
Family: NE0241-like



Orphan Member
 
Domain: d1zx3a1 of protein: Hypothetical protein NE0241 from Species: Nitrosomonas europaea [TaxId: 915]




>1zx3a1(a.43.1.6)
EVQQPDPMRKNWIMENMDSGVIYLLESWLKAKSQETGKEISDIFANAVEFNIVLKDWGKEKLEETNTEYQNQQRKLRKTYIEYYDR

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)