Trafficking protein A-like (a.43.1.8)


SCOP classification
 
Class: All alpha proteins
Fold: Ribbon-helix-helix
Superfamily: Ribbon-helix-helix
Family: Trafficking protein A-like



Orphan Member
 
Domain: d2h1oh1 of protein: Trafficking protein A from Species: Neisseria gonorrhoeae [TaxId: 485]




>2bsqh1(a.43.1.8)
ASVVIRNLSEATHNAIKFRARAAGRSTEAEIRLILDNIAKAQQTVRLGSMLASIGQEIGGVELE

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)