VCA0319-like (a.43.1.9)


SCOP classification
 
Class: All alpha proteins
Fold: Ribbon-helix-helix
Superfamily: Ribbon-helix-helix
Family: VCA0319-like



Orphan Member
 
Domain: d1y9bb_ of protein: Hypothetical protein VCA0482 (VCA0319) from Species: Vibrio cholerae [TaxId: 666]




>1y9bb1(a.43.1.9)
PRITARVDVDTQDLLAKAAALAGMSSINSFVLNAAIEKAKQVIEREQALKLSQADAVLLMEALDNPAVVNAKLKLASE

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)