Methionine synthase domain (a.46.1.1)


SCOP classification
 
Class: All alpha proteins
Fold: Methionine synthase domain-like
Superfamily: Methionine synthase domain
Family: Methionine synthase domain



Orphan Member
 
Domain: d3ivaa1 of protein: Methionine synthase domain from Species: Escherichia coli [TaxId: 562]




>1k7ya1(a.46.1.1)
QAEWRSWEVNKRLEYSLVKGITEFIEQDTEEARQQATRPIEVIEGPLMDGMNVVGDLFGEGKMFLPQVVKSARVMKQAVAYLEPFIEASK

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)