Hypothetical protein AF0491, middle domain (a.5.8.1)


SCOP classification
 
Class: All alpha proteins
Fold: RuvA C-terminal domain-like
Superfamily: Hypothetical protein AF0491, middle domain
Family: Hypothetical protein AF0491, middle domain



Orphan Member
 
Domain: d1t95a1 of protein: Hypothetical protein AF0491, middle domain from Species: Archaeoglobus fulgidus [TaxId: 2234]




>1t95a1(a.5.8.1)
LEGEVQITAEQRREMLEAKRKQIINFISRNTIDPRTNAPHPPSRIERALEEAKVHIDIFKSVEAQVKDIVKALKP

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)