Protein HNS-dependent expression A; HdeA (a.57.1.1)


SCOP classification
 
Class: All alpha proteins
Fold: Protein HNS-dependent expression A; HdeA
Superfamily: Protein HNS-dependent expression A; HdeA
Family: Protein HNS-dependent expression A; HdeA



Orphan Member
 
Domain: d1dj8f_ of protein: Protein HNS-dependent expression A; HdeA from Species: Escherichia coli [TaxId: 562]




>1dj8f_(a.57.1.1)
NKKPVNSWTCEDFLAVDESFQPTAVGFAEALNNKDKPEDAVLDVQGIATVTPAIVQACTQDKQANFKDKVKGEWDKIKK

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)