Chemotaxis receptor methyltransferase CheR, N-terminal domain (a.58.1.1)


SCOP classification
 
Class: All alpha proteins
Fold: Chemotaxis receptor methyltransferase CheR, N-terminal domain
Superfamily: Chemotaxis receptor methyltransferase CheR, N-terminal domain
Family: Chemotaxis receptor methyltransferase CheR, N-terminal domain



Orphan Member
 
Domain: d1bc5a1 of protein: Chemotaxis receptor methyltransferase CheR, N-terminal domain from Species: Salmonella typhimurium [TaxId: 90371]




>1af7a1(a.58.1.1)
SVLLQMTQRLALSDAHFRRICQLIYQRAGIVLADHKRDMVYNRLVRRLRALGLDDFGRYLSMLEANQNSAEWQAFINALTT

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)