Hypothetical protein YjbJ (a.60.11.1)


SCOP classification
 
Class: All alpha proteins
Fold: SAM domain-like
Superfamily: Hypothetical protein YjbJ
Family: Hypothetical protein YjbJ



Orphan Member
 
Domain: d1ryka_ of protein: Hypothetical protein YjbJ from Species: Escherichia coli [TaxId: 562]




>1ryka_(a.60.11.1)
MNKDEAGGNWKQFKGKVKEQWGKLTDDDMTIIEGKRDQLVGKIQERYGYQKDQAEKEVVDWETRNEYRW

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)