NAD+-dependent DNA ligase, domain 3 (a.60.2.2)


SCOP classification
 
Class: All alpha proteins
Fold: SAM domain-like
Superfamily: RuvA domain 2-like
Family: NAD+-dependent DNA ligase, domain 3



Orphan Member
 
Domain: d1v9pb1 of protein: NAD+-dependent DNA ligase, domain 3 from Species: Thermus filiformis [TaxId: 276]




>1v9pb1(a.60.2.2)
RWPETCPECGHRLVKEGKVHRCPNPLCPAKRFEAIRHYASRKAMDIEGLGEKLIERLLEKGLVRDVADLYHLRKEDLLGLERMGEKSAQNLLRQIEESKHRGLERLLYALGLPGVGEVLARNLARRFGTMDRLLEASLEELLEVEEVGELTARAILETLKDPAFRDLVRRLKEAGVSMESK

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)