Excinuclease UvrC C-terminal domain (a.60.2.3)


SCOP classification
 
Class: All alpha proteins
Fold: SAM domain-like
Superfamily: RuvA domain 2-like
Family: Excinuclease UvrC C-terminal domain



Orphan Member
 
Domain: d1kfta_ of protein: Excinuclease UvrC C-terminal domain from Species: Escherichia coli [TaxId: 562]




>1kfta_(a.60.2.3)
TSSLETIEGVGPKRRQMLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIFWSLKH

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)