Hypothetical protein AF1548, C-terminal domain (a.60.4.3)


SCOP classification
 
Class: All alpha proteins
Fold: SAM domain-like
Superfamily: Rad51 N-terminal domain-like
Family: Hypothetical protein AF1548, C-terminal domain



Orphan Member
 
Domain: d1y88a1 of protein: Hypothetical protein AF1548, C-terminal domain from Species: Archaeoglobus fulgidus [TaxId: 2234]




>1y88a1(a.60.4.3)
YPITILRIDKEVLDELVRAGLVFCRDVVSAGEEKLREIGLSAKKAREVIAEAKKVIGGS

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)