Alpha-hemoglobin stabilizing protein AHSP (a.7.11.1)


SCOP classification
 
Class: All alpha proteins
Fold: Spectrin repeat-like
Superfamily: Alpha-hemoglobin stabilizing protein AHSP
Family: Alpha-hemoglobin stabilizing protein AHSP



Orphan Member
 
Domain: d3ovua_ of protein: Alpha-hemoglobin stabilizing protein AHSP from Species: Human (Homo sapiens) [TaxId: 9606]




>1z8uc1(a.7.11.1)
ALLKANKDLISAGLKEFSVLLNQQVFNDALVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKS

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)