XseB-like (a.7.13.1)


SCOP classification
 
Class: All alpha proteins
Fold: Spectrin repeat-like
Superfamily: XseB-like
Family: XseB-like



Orphan Member
 
Domain: d1vp7f_ of protein: Exonuclease VII small subunit XseB from Species: Bordetella pertussis [TaxId: 520]




>1vp7f_(a.7.13.1)
ARPLPQDFETALAELESLVSAMENLPLEQSLSAYRRGVELARVCQDRLAQAEQQVKVLEGDLLRP

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)