Cas Cmr5-like (a.70.2.1)


SCOP classification
 
Class: All alpha proteins
Fold: ATPD N-terminal domain-like
Superfamily: AF1862-like
Family: Cas Cmr5-like



Orphan Member
 
Domain: d2oeba1 of protein: Hypothetical protein AF1862 from Species: Archaeoglobus fulgidus [TaxId: 2234]




>d2oeba1|a.70.2.1
DIREIEQERASFAFKVVSDIKDKYSQNKKVQGKYSSYAEKAPTIILNNGLGATLAFFLSK
LEKPIDDVDYKSINPESFGNAENIAYAFLYKHLSTWLAEGNGKDSAFSGLTNGEDPLKYI
MEKTAIDVAISTEEALSILNWIKKFAKAMLEE

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)