GntR ligand-binding domain-like (a.78.1.1)


SCOP classification
 
Class: All alpha proteins
Fold: GntR ligand-binding domain-like
Superfamily: GntR ligand-binding domain-like
Family: GntR ligand-binding domain-like



Orphan Member
 
Domain: d2hs5a2 of protein: Putative transcriptional regulator RHA1_ro03477 from Species: Rhodococcus sp. RHA1 [TaxId: 101510]




>1hw1b2(a.78.1.1)
GLNILETLARLDHESVPQLIDNLLSVRTNISTIFIRTAFRQHPDKAQEVLATANEVADHADAFAELDYNIFRGLAFASGNPIYGLILNGMKGLYTRIGRHYFANPEARSLALGFYHKLSALCSEGAHDQVYETVRRYGHESGEIWHRMQKNL

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)