RmsB N-terminal domain-like (a.79.1.3)


SCOP classification
 
Class: All alpha proteins
Fold: NusB-like
Superfamily: NusB-like
Family: RmsB N-terminal domain-like



Orphan Member
 
Domain: d1sqga1 of protein: Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), N-terminal domain from Species: Escherichia coli [TaxId: 562]




>1sqga1(a.79.1.3)
RNLRSMAAQAVEQVVEQGQSLSNILPPLQQKVSDKDKALLQELCFGVLRTLSQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQLKGLINGVLRQFQRQQEELLAEFNASDARYL

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)