Vng1086c-like (a.8.10.1)


SCOP classification
 
Class: All alpha proteins
Fold: immunoglobulin/albumin-binding domain-like
Superfamily: Vng1086c-like
Family: Vng1086c-like



Orphan Member
 
Domain: d2gf4b_ of protein: Nypothetical protein Vng1086c from Species: Halobacterium salinarium [TaxId: 2242]




>2gf4a1(a.8.10.1)
MHKDELLELHEQMVNIKDQFLGFDHVDETAFAAYEELDVEPSHVHKSKSEHKHAVFLLGNALAAAMSEDEFSSAGRISKRMEELADDAS

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)