4-alpha-glucanotransferase, domain 2 (a.8.3.2)


SCOP classification
 
Class: All alpha proteins
Fold: immunoglobulin/albumin-binding domain-like
Superfamily: Families 57/38 glycoside transferase middle domain
Family: 4-alpha-glucanotransferase, domain 2



Orphan Member
 
Domain: d1k1yb1 of protein: 4-alpha-glucanotransferase, domain 2 from Species: Thermococcus litoralis [TaxId: 2265]




>1k1yb1(a.8.3.2)
GIWKNFFFKYPESNFMHKRMLMVSKAVRDNPEARKYILKAQCNDAYWHGVFGGIYLPHLRRTVWENIIKAQRYL

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)