N-terminal domain of DnaB helicase (a.81.1.1)


SCOP classification
 
Class: All alpha proteins
Fold: N-terminal domain of DnaB helicase
Superfamily: N-terminal domain of DnaB helicase
Family: N-terminal domain of DnaB helicase



Orphan Member
 
Domain: d1jwea_ of protein: N-terminal domain of DnaB helicase from Species: Escherichia coli [TaxId: 562]




>1b79c_(a.81.1.1)
PPHSIEAEQSVLGGLMLDNERWDDVAERVVADDFYTRPHRHIFTEMARLQESGSPIDLITLAESLERQGQLDSVGGFAYLAELSKNTPSAANISAYADIVRE

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)