LigA subunit of an aromatic-ring-opening dioxygenase LigAB (a.88.1.1)


SCOP classification
 
Class: All alpha proteins
Fold: LigA subunit of an aromatic-ring-opening dioxygenase LigAB
Superfamily: LigA subunit of an aromatic-ring-opening dioxygenase LigAB
Family: LigA subunit of an aromatic-ring-opening dioxygenase LigAB



Orphan Member
 
Domain: d1bouc_ of protein: LigA subunit of an aromatic-ring-opening dioxygenase LigAB from Species: Sphingomonas paucimobilis, formerly Pseudomonas paucimobilis [TaxId: 13689]




>1bouc_(a.88.1.1)
IDVHAYLAEFDDIPGTRVFTAQRARKGYNLNQFAMSLMKAENRERFKADESAYLDEWNLTPAAKAAVLARDYNAMIDEGGNVYFLSKLFSTDGKSFQFAAGSMTGMTQEEYAQMMIDGGRSPAGVRSIKGGY

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)