Transcription factor STAT-4 N-domain (a.90.1.1)


SCOP classification
 
Class: All alpha proteins
Fold: Transcription factor STAT-4 N-domain
Superfamily: Transcription factor STAT-4 N-domain
Family: Transcription factor STAT-4 N-domain



Orphan Member
 
Domain: d1bgfa_ of protein: Transcription factor STAT-4 N-domain from Species: Mouse (Mus musculus) [TaxId: 10090]




>1bgfa_(a.90.1.1)
GGGSQWNQVQQLEIKFLEQVDQFYDDNFPMEIRHLLAQWIETQDWEVASNNETMATILLQNLLIQLDEQLGRVSKEKNLLLIHNLKRIRKVLQGKFHGNPMHVAVVISNCLREERRILAAANMPI

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)