Cytomegalovirus protein US2 (b.1.18.5)


SCOP classification
 
Class: All beta proteins
Fold: Immunoglobulin-like beta-sandwich
Superfamily: E set domains
Family: Cytomegalovirus protein US2



Orphan Member
 
Domain: d1im3p_ of protein: Cytomegalovirus protein US2 from Species: Human cytomegalovirus [TaxId: 10359]




>1im3p_(b.1.18.5)
PWFQIEDNRCYIDNGKLFARGSIVGNMSRFVFDPKADYGGVGENLYVHADDVEFVPGESLKWNVRNLDVMPIFETLALRLVLQGDVIWLRCVPEL

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)