ASF1-like (b.1.22.1)


SCOP classification
 
Class: All beta proteins
Fold: Immunoglobulin-like beta-sandwich
Superfamily: ASF1-like
Family: ASF1-like



Orphan Member
 
Domain: d2z3fh1 of protein: Anti-silencing protein 1, ASF1 from Species: Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]




>1roca_(b.1.22.1)
GGASIVSLLGIKVLNNPAKFTDPYEFEITFECLESLKHDLEWKLTYVGSSRSLDHDQELDSILVGPVPVGVNKFVFSADPPSAELIPASELVSVTVILLSCSYDGREFVRVGYYVNNEYDEEELRENPPAKVQVDHIVRNILAEKPRVTRFNIVWD

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)