Accessory protein X4 (ORF8, ORF7a) (b.1.24.1)


SCOP classification
 
Class: All beta proteins
Fold: Immunoglobulin-like beta-sandwich
Superfamily: Accessory protein X4 (ORF8, ORF7a)
Family: Accessory protein X4 (ORF8, ORF7a)



Orphan Member
 
Domain: d1yo4a_ of protein: automated matches from Species: SARS coronavirus [TaxId: 227859]




>1xaka_(b.1.24.1)
CELYHYQECVRGTTVILKEPCPSGTYEGNSPFHPLADNKFALTCTSTHFAFACADGTRHTYQLRARSV

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)