AF2212-like (b.129.2.2)


SCOP classification
 
Class: All beta proteins
Fold: Immunoglobulin-like beta-sandwich
Superfamily: CBD9-like
Family: Family 9 carbohydrate-binding module, CBD9



Orphan Member
 
Domain: d1i8ua_ of protein: Xylanase 10A from Species: Thermotoga maritima [TaxId: 2336]




>1i8ua_(b.1.9.2)
MMVATAKYGTPVIDGEIDEIWNTTEEIETKAVAMGSLDKNATAKVRVLWDENYLYVLAIVKDPVLNKDNSNPWEQDSVEIFIDENNHKTGYYEDDDAQFRVNYMNEQTFGTGGSPARFKTAVKLIEGGYIVEAAIKWKTIKPTPNTVIGFNIQVNDANEKGQRVGIISWSDPTNNSWRDPSKFGNLRLIK

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)