Viral chemokine binding protein m3 (b.116.1.1)


SCOP classification
 
Class: All beta proteins
Fold: Viral chemokine binding protein m3
Superfamily: Viral chemokine binding protein m3
Family: Viral chemokine binding protein m3



Orphan Member
 
Domain: d2nz1x_ of protein: Viral chemokine binding protein m3 from Species: Murid herpesvirus 4, MuHV-4 [TaxId: 33708]




>1mkfb_(b.116.1.1)
HSSGVSTQSVDLSQIKRGDEIQAHCLTPAETEVTECAGILKDVLSKNLHELQGLCNVKNKMGVPWVSVEELGQEIITGRLPFPSVGGTPVNDLVRVLVVAESNTPEETPEEEFYAYVELQTELYTFGLSDDNVVFTSDYMTVWMIDIPKSYVDVGMLTRATFLEQWPGAKVTVMIPYSSTFTWCGELGAISEESAPQPSLSARSPVCKNSARYSTSKFCEVDGCTAETGMEKMSLLTPFGGPPQQAKMNTCPCYYKYSVSPLPAMDHLILADLAGLDSLTSPVYVMAAYFDSTHENPVRPSSKLYHCALQMTSHDGVWTSTSSEQCPIRLVEGQSQNVLQVRVAPTSMPNLVGVSLMLEGQQYRLEYFGDH

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)