Birnaviridae-like VP (b.121.4.9)


SCOP classification
 
Class: All beta proteins
Fold: Nucleoplasmin-like/VP (viral coat and capsid proteins)
Superfamily: Positive stranded ssRNA viruses
Family: Birnaviridae-like VP



Orphan Member
 
Domain: d2df7t_ of protein: automated matches from Species: Infectious bursal disease virus [TaxId: 10995]




>2df7s1(b.121.4.9)
VPFIRSLLMPTTGPASIPDDTLEKHTLRSETSTYNLTVGDTGSGLIVFFPGFPGSIVGAHYTLQSNGNYKFDQMLLTAQNLPASYNYCRLVSRSLTVRSSTLPGGVLNGTINAVTFQGSLSELTDVSYNGLMSATANINDKIGNVLVGEGVTVLSLPTSYDLGYVRLGDPIPAIGLDPKMVATCDSSDRPRVYTITAADDYQFSSQYQSGGVTITLFSANIDAITSLSIGGELVFHTSVHGLALDATIYLIGFDGTTVITRAVASDNGLTTGIDNLMPFNLVIPTNEITQPITSIKLEIVTSKSGGQAGDQMSWSASGSLAVTIHGGNYPGALRPVTLVAYERVATGSVVTVAGVSNFELIPNPELAKNLVTEYGRFDPGAMNYTKLILSERERLGIKTVWPTREYTDFREYFM

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)