Hypothetical protein EF3133 (b.122.1.4)


SCOP classification
 
Class: All beta proteins
Fold: PUA domain-like
Superfamily: PUA domain-like
Family: Hypothetical protein EF3133



Orphan Member
 
Domain: d1t62b_ of protein: Hypothetical protein EF3133 from Species: Enterococcus faecalis [TaxId: 1351]




>1t62b_(b.122.1.4)
MLKNVEVFWQNFLDKHELDMLMPDVWMFGDGSSEMGNRLGQLVVSGRKTATCSSLDIYKMEEEQLPKAGQYDIILDGQSQPLAIIRTTKVEIMPMNKVSESFAQAEGLTLDYWYEEHARFFKEELAPYQLQFYPDMLLVCQSFEVVDLYTEKEEGGSHHHHHH

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)