yqfB-like (b.122.1.7)


SCOP classification
 
Class: All beta proteins
Fold: PUA domain-like
Superfamily: PUA domain-like
Family: yqfB-like



Orphan Member
 
Domain: d1te7a_ of protein: Hypothetical protein YqfB from Species: Escherichia coli [TaxId: 562]




>1te7a_(b.122.1.7)
MQPNDITFFQRFQDDILAGRKTITIRDESESHFKTGDVLRVGRFEDDGYFCTIEVTATSTVTLDTLTEKHAEQENMTLTELKKVIADIYPGQTQFYVIEFKCL

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)