Hypothetical protein TM1070 (b.123.1.1)


SCOP classification
 
Class: All beta proteins
Fold: Hypothetical protein TM1070
Superfamily: Hypothetical protein TM1070
Family: Hypothetical protein TM1070



Orphan Member
 
Domain: d1nc7d_ of protein: Hypothetical protein TM1070 from Species: Thermotoga maritima [TaxId: 2336]




>1nc7c_(b.123.1.1)
MNGARKWFFPDGYIPNGKRGYLVSHESLCIMNTGDETAKIRITFLFEDSKPVVHEVEISPMKSLHLRLDKLGIPKCKPYSIMAESNVPVVMQLSRLDVGKNHYTLMTTIGYWEEGS

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)