PG0164-like (b.129.2.1)


SCOP classification
 
Class: All beta proteins
Fold: Double-split beta-barrel
Superfamily: AF2212/PG0164-like
Family: PG0164-like



Orphan Member
 
Domain: d2d9ra1 of protein: Hypothetical protein PG0164 from Species: Porphyromonas gingivalis [TaxId: 837]




>2d9ra1(b.129.2.1)
SPIEFDAIIRQVPDMDAAYVEIPFDVKTVYGKGRVRVNATFDGYPYTGYIVRMGLPCHILGLRQDIRRAIGKQPGDSVYVTLLPL

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)