NAC domain (b.143.1.1)


SCOP classification
 
Class: All beta proteins
Fold: NAC domain
Superfamily: NAC domain
Family: NAC domain



Orphan Member
 
Domain: d3ulxa_ of protein: automated matches from Species: Oryza sativa [TaxId: 39947]




>1ut7b_(b.143.1.1)
GSHMGIQETDPLTQLSLPPGFRFYPTDEELMVQYLCRKAAGYDFSLQLIAEIDLYKFDPWVLPNKALFGEKEWYFFSPRDPNRVAGSGYWKATGTDKIISTEGQRVGIKKALVFYIGKAPKGTKTNWIMHEYRLIEPSDDWVLCRIYKKQ

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)