BTV NS2-like ssRNA-binding domain (b.147.1.1)


SCOP classification
 
Class: All beta proteins
Fold: BTV NS2-like ssRNA-binding domain
Superfamily: BTV NS2-like ssRNA-binding domain
Family: BTV NS2-like ssRNA-binding domain



Orphan Member
 
Domain: d1utyb_ of protein: Nonstructural protein NS2 from Species: Bluetongue virus [TaxId: 40051]




>1utyb_(b.147.1.1)
FTKNIFVLDVTAKTLCGAIAKLSSQPYCQIKIGRVVAFKPVKNPEPKGYVLNVPGPGAYRIQDGQDIISLMLTPHGVEATTERWEEWKFEGVSVTPMATRVQYNGVMVDAEIKYCKGMGIVQPYMRNDFDRNEMPDLPGVMRSNYDIRELRQK

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)