Beta-galactosidase LacA, domain 3 (b.149.1.1)


SCOP classification
 
Class: All beta proteins
Fold: Beta-galactosidase LacA, domain 3
Superfamily: Beta-galactosidase LacA, domain 3
Family: Beta-galactosidase LacA, domain 3



Orphan Member
 
Domain: d1xc6a1 of protein: Beta-galactosidase LacA, domain 3 from Species: Penicillium sp. [TaxId: 5081]




>1tg7a1(b.149.1.1)
RNSAYNYWVPQVPTKGTAPGYSNQETTASSIIVKAGYLVRSAYLDGNDLHIQADFNATTPIEVVGAPSGAKNLVINGKKTQTKVDKNGIWSASVAYT

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)