BH3618-like (b.158.1.1)


SCOP classification
 
Class: All beta proteins
Fold: BH3618-like
Superfamily: BH3618-like
Family: BH3618-like



Orphan Member
 
Domain: d2aj7b_ of protein: Hypothetical protein BH3618 from Species: Bacillus halodurans [TaxId: 86665]




>2aj7b1(b.158.1.1)
MKVIETKYSGKLEVAEDRLIAFDQGIPAFEDEKEFVLLPFAAGTPYYTLQSTKTVDLAFIIVNPFSFFPEYRVKLPEATIAQLNITNENDVAIFSLLTVKEPFSETTVNLQAPIVINANKQMGKQLVLGDTAYNRKQPLFQKELVL

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)