automated matches (b.172.1.0)


SCOP classification
 
Class: All beta proteins
Fold: YopX-like
Superfamily: YopX-like
Family: automated matches



Orphan Member
 
Domain: d2qyza_ of protein: automated matches from Species: Clostridium tetani [TaxId: 212717]




>d2qyza_|b.172.1.0
NREVKFRAWDKELNMMVYTKEQTGHIEYNTNPADTINIILNQDDYGYVFMQYTGLKDKNE
KEIYEGDIIKKSNRSSNLYEIIYQDSIACFRCKVIKGDIKSFPCLNIGTVRNCEVIGNIY
ENPELLE

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)