NifT/FixU (b.173.1.1)


SCOP classification
 
Class: All beta proteins
Fold: NifT/FixU barrel-like
Superfamily: NifT/FixU-like
Family: NifT/FixU



Orphan Member
 
Domain: d2jn4a1 of protein: Uncharacterized protein FixU (NifT) from Species: Rhodopseudomonas palustris [TaxId: 1076]




>d2jn4a1|b.173.1.1
MKVMIRKTATGHSAYVAKKDLEELIVEMENPALWGGKVTLANGWQLELPAMAADTPLPIT
VEARKL

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)