F-box associated region, FBA (b.18.1.21)


SCOP classification
 
Class: All beta proteins
Fold: Galactose-binding domain-like
Superfamily: Galactose-binding domain-like
Family: F-box associated region, FBA



Orphan Member
 
Domain: d2rj2a_ of protein: automated matches from Species: Mouse (Mus musculus) [TaxId: 10090]




>1umha_(b.18.1.21)
GSHFYFLSKRRRNLLRNPCGEEDLEGWSDVEHGGDGWKVEELPGDNGVEFTQDDSVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRTDAGSLYELTVRLLSENEDVLAEFATGQVAVPEDGSWMEISHTFIDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)