YxiM N-terminal domain-like (b.18.1.32)


SCOP classification
 
Class: All beta proteins
Fold: Galactose-binding domain-like
Superfamily: Galactose-binding domain-like
Family: YxiM N-terminal domain-like



Orphan Member
 
Domain: d2o14a1 of protein: Hypothetical protein YxiM from Species: Bacillus subtilis [TaxId: 1423]




>d2o14a1|b.18.1.32
KVYQFDFGSGSEPGYIGVRASDRYDRSKGYGFQTPENRDVAASGAGVKSDAVEFLAYGTK
SNNTFNVDLPNGLYEVKVTLGNTARASVAAEGVFQVINTGDGAEDTFQIPVTDGQLNLLV
TEGKAGTAFTLSALKIKKLSDQP

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)